PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G18140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 417aa    MW: 42702.2 Da    PI: 9.1242
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G18140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.8e-42102179178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC adls +k+y+ rhkvC +hskap v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrr++q+
  OPUNC08G18140.1 102 RCQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRRPQT 179
                      6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-3599164IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.47100177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-40101180IPR004333Transcription factor, SBP-box
PfamPF031104.9E-32103176IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MEMASGGAAA GGVGGGGGGG GDEHRQLHGL KFGKKIYFED ATTAASGGTG TGTGTGTGSA  60
SAAPTSSSKA AAAGGGGRGG VGKNKGKGVA APAPAPPPPP PRCQVEGCGA DLSGIKNYYC  120
RHKVCFMHSK APRVVVAGLE QRFCQQCSRF HLLPEFDQGK RSCRRRLAGH NERRRRPQTP  180
LASRYGRLAA SVGEEQRRFR SFTLDFSYPR VPSSVRNAWP AIQPGDRISG GIQWHGNLAP  240
HAHTSAVAGY GTHAYSGQGS SASGPPVFPG PNLPPGGCLA GVGATTDSSC ALSLLSTQPW  300
DTTTHSATTS HNQAAAMSTT TSFDGNPVAP SAMAGSYMAP SPWTGSRGHE GGGQSVAHQL  360
PHEVSLDEVH PGPSHHAHFS GELELALQGN GPAPAPRIDP GSSSTFDQTS NTMDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291031761184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071910.0AK107191.1 Oryza sativa Japonica Group cDNA clone:002-125-A04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650813.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ7EXZ20.0SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLA0A0E0LWR00.0A0A0E0LWR0_ORYPU; Uncharacterized protein
STRINGORGLA08G0176500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-42squamosa promoter binding protein-like 9